PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03657.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 354aa    MW: 38082.1 Da    PI: 8.4777
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03657.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.6e-153989148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT...TTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg...kgRtlkqcksrwqkyl 48
                                  +g W++eEde+l++ + ++G g+W+++++  g   + R++k+c++rw +yl
  Zmw_sc03657.1.g00040.1.am.mk 39 KGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGthwLQRCGKSCRLRWINYL 89
                                  678**********************************************97 PP

2Myb_DNA-binding47.63.8e-1595138146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++
  Zmw_sc03657.1.g00040.1.am.mk  95 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNS 138
                                   899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-223492IPR009057Homeodomain-like
PROSITE profilePS5129415.4213489IPR017930Myb domain
SuperFamilySSF466891.09E-2837136IPR009057Homeodomain-like
SMARTSM007177.2E-123891IPR001005SANT/Myb domain
PfamPF002491.1E-133989IPR001005SANT/Myb domain
CDDcd001671.30E-114289No hitNo description
PROSITE profilePS5129424.51790144IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2593144IPR009057Homeodomain-like
SMARTSM007172.2E-1494142IPR001005SANT/Myb domain
PfamPF002491.7E-1395139IPR001005SANT/Myb domain
CDDcd001672.79E-1097137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
LPSGSQFVRP AVSIERAVAA GMGRQPGSTG GGVQQKLRKG LWSPEEDEKL YNHIIRYGVG  60
CWSSVPKLAG THWLQRCGKS CRLRWINYLR PDLKRGSFSQ QEEDAIVGLH EILGNRWSQI  120
ASHLPGRTDN EIKNFWNSCL KKKLRQRGID PSTHKPISSA NSAAAAASED QKQQAASADG  180
GITANPKQQQ HVFDPFPLTD SFGGGFVDAA LYGHLGGGKD AAGGFVDYSS VLDVSENLGY  240
GESSSNSSNN WNCAPEVNDG DALHWGSENK QGSEHYDPRA RYHEEQMAAR RMQPRAARAR  300
TGSEHLVGLV PPDDRRGGSQ ETHVDSGTNA TAGGGGSGQM GRPFRGAAAP SLLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27371445108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139145LKKKLRQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150099.11e-129myb-related protein Hv33
SwissprotP200271e-101MYB3_HORVU; Myb-related protein Hv33
TrEMBLB6TL401e-129B6TL40_MAIZE; Myb-related protein Hv33
STRINGGRMZM2G003406_P011e-124(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391